(data stored in ACNUC7421 zone)

EMBL: CP000769.PE257

CP000769.PE257       Location/Qualifiers
FT   CDS             297168..300929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0259"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ade:Adeh_0237 tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24477"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y1"
FT                   /protein_id="ABS24477.1"
FT                   /translation="MSRPLAALLALAVVAPLPVARAAGGAPGARGADPEAALRAEAIAA
FT                   LARDRRGPRGIVALAELGELEAEAPELAPLAAAYAAAVEDRAAHPEVRALARHRLAALE
FT                   RSRGNFQRSAAQVRRLGFVTRWHVVGPFDDEGKRGLDTAYAPEQGIDLAARHDGKVGEV
FT                   AWRPLPDEAVVHGFVDLGAALRPASEGVAYAVAFVEAARDERVALWLGASGAAKVWVNG
FT                   AVVVADAGYHPARLDQRGAVVTLRRGTNRILVKLCHQLGRMGFFLRLADERGDGRARAA
FT                   GSPDAPAPEPGPAASPIDGAVARLEAQARGARTRAEEAAARRDLAIVLAERQSADFEER
FT                   RPAAEARRAAELAPRSAELQLLAASMEEDHGRRRRYVEAALAARPEEPRALAALAREEL
FT                   DQGRPHAALRLLDRAVAAAPRWAAPRVARVEALDRAGLEVRAVRAAAEAADAFPTTPGA
FT                   VRAAARAAGRLNRVEEAVARLRTLLALRLDDAEARGTLAHLLVERGEVATAAALLAEAL
FT                   RLDPAAGEQRLRLADLLAANGRGEEAEAAYEAALRIAPADADALERRGRARLAAGRPRD
FT                   ALQDLHAALDLRPQSPELKELVRSLEPARERFEAPYVLDARALAANAPAPRADDDAIVL
FT                   GELKVTRVFPSGLSATFHQQVVKIVSARGAEAFRRHVIGWTPDRQDVRVERVRIVKPDG
FT                   SSVETHDAAERSASEPWYRLYYDTRTRTLSFPSLGAGDVLEVAWRIEDSARENLLSDYF
FT                   GDLTFLDDTTRKARVDYVLLVPEARPIYSSVPEGVRHETRKLSGGLVEHRFAARELARI
FT                   RPEPGMPGWSEVARYVHVSTYGDWDQVARFYWGLVKDQLRPTDELRATSARIVEAAVGA
FT                   TRLQPVAARAGGAAPAAQGGWTLDQKRAIARGVYDFVVSQTRYVGLEFGIHGYKPYRVD
FT                   QVLARRFGDCKDKASLVHALLASAGIDSRLVLLRMRRLGRMPEAPASLAVFNHAIVYVP
FT                   ELDLWLDGTAAHSGSGDLPSEDRGATVLVVNPGGKARFGTVPQARPEDNRLESRFEVTL
FT                   GADGRARVRGSSRVRGSQAPQYRRAYLAEHERRAQLERAFGRTFPGAEVTGLSVSDLTR
FT                   IEEDVAMEFTLDVPRYALADGGGLRFTPFGDVAGYAQSYAALSARRYDLVVGDPGITRF
FT                   TYRYVLPAGWAPVEVPEPAAADTPHGAFEVRYRREGDALVAEGHVTFKAARVAAAEYPA
FT                   FRDLAARIDRAFARKVRIAPAAAGEGSR"
     MSRPLAALLA LAVVAPLPVA RAAGGAPGAR GADPEAALRA EAIAALARDR RGPRGIVALA        60
     ELGELEAEAP ELAPLAAAYA AAVEDRAAHP EVRALARHRL AALERSRGNF QRSAAQVRRL       120
     GFVTRWHVVG PFDDEGKRGL DTAYAPEQGI DLAARHDGKV GEVAWRPLPD EAVVHGFVDL       180
     GAALRPASEG VAYAVAFVEA ARDERVALWL GASGAAKVWV NGAVVVADAG YHPARLDQRG       240
     AVVTLRRGTN RILVKLCHQL GRMGFFLRLA DERGDGRARA AGSPDAPAPE PGPAASPIDG       300
     AVARLEAQAR GARTRAEEAA ARRDLAIVLA ERQSADFEER RPAAEARRAA ELAPRSAELQ       360
     LLAASMEEDH GRRRRYVEAA LAARPEEPRA LAALAREELD QGRPHAALRL LDRAVAAAPR       420
     WAAPRVARVE ALDRAGLEVR AVRAAAEAAD AFPTTPGAVR AAARAAGRLN RVEEAVARLR       480
     TLLALRLDDA EARGTLAHLL VERGEVATAA ALLAEALRLD PAAGEQRLRL ADLLAANGRG       540
     EEAEAAYEAA LRIAPADADA LERRGRARLA AGRPRDALQD LHAALDLRPQ SPELKELVRS       600
     LEPARERFEA PYVLDARALA ANAPAPRADD DAIVLGELKV TRVFPSGLSA TFHQQVVKIV       660
     SARGAEAFRR HVIGWTPDRQ DVRVERVRIV KPDGSSVETH DAAERSASEP WYRLYYDTRT       720
     RTLSFPSLGA GDVLEVAWRI EDSARENLLS DYFGDLTFLD DTTRKARVDY VLLVPEARPI       780
     YSSVPEGVRH ETRKLSGGLV EHRFAARELA RIRPEPGMPG WSEVARYVHV STYGDWDQVA       840
     RFYWGLVKDQ LRPTDELRAT SARIVEAAVG ATRLQPVAAR AGGAAPAAQG GWTLDQKRAI       900
     ARGVYDFVVS QTRYVGLEFG IHGYKPYRVD QVLARRFGDC KDKASLVHAL LASAGIDSRL       960
     VLLRMRRLGR MPEAPASLAV FNHAIVYVPE LDLWLDGTAA HSGSGDLPSE DRGATVLVVN      1020
     PGGKARFGTV PQARPEDNRL ESRFEVTLGA DGRARVRGSS RVRGSQAPQY RRAYLAEHER      1080
     RAQLERAFGR TFPGAEVTGL SVSDLTRIEE DVAMEFTLDV PRYALADGGG LRFTPFGDVA      1140
     GYAQSYAALS ARRYDLVVGD PGITRFTYRY VLPAGWAPVE VPEPAAADTP HGAFEVRYRR      1200
     EGDALVAEGH VTFKAARVAA AEYPAFRDLA ARIDRAFARK VRIAPAAAGE GSR             1253
//

If you have problems or comments...

PBIL Back to PBIL home page