(data stored in ACNUC7421 zone)

EMBL: CP000769.PE259

CP000769.PE259       Location/Qualifiers
FT   CDS             complement(305306..305920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24479"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y3"
FT                   /protein_id="ABS24479.1"
FT                   /translation="MRRLLGLAVLGLSLGAGLAVMFRVLPSDRPMPAPPAVATQIREVA
FT                   RLETLEVRLYKKVSFAPEPTPAGSFWGDVAGWLRHAVSAPQGKAIVFADAYLTLDLERL
FT                   NANSVQVEGRRVDVVLPPIRTTVALRPGETEVLGSNLDSADTARLLELAKAAFEREVDA
FT                   DAALQARARASAERHIRALLLSLGFEDVRFVDVLPPARSQT"
     MRRLLGLAVL GLSLGAGLAV MFRVLPSDRP MPAPPAVATQ IREVARLETL EVRLYKKVSF        60
     APEPTPAGSF WGDVAGWLRH AVSAPQGKAI VFADAYLTLD LERLNANSVQ VEGRRVDVVL       120
     PPIRTTVALR PGETEVLGSN LDSADTARLL ELAKAAFERE VDADAALQAR ARASAERHIR       180
     ALLLSLGFED VRFVDVLPPA RSQT                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page