(data stored in ACNUC7421 zone)

EMBL: CP000769.PE261

CP000769.PE261       Location/Qualifiers
FT   CDS             complement(306363..307502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0263"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: ade:Adeh_0241 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: putative
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24481"
FT                   /db_xref="GOA:A7H6Y5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y5"
FT                   /protein_id="ABS24481.1"
FT                   /translation="MARRFGIYVHFPYCAHRCPYCDFAVTTERPPEGRRYLAALLAELE
FT                   LRAGAFDGLAPVSVYLGGGTPSLWDPDEVAALLAALRARLALPAGAEVTIEANPESTDR
FT                   ARLRAWRAAGVNRVSVGVQSFDAGVLAKLGRRHGPDAAERAIREAAEELGNVSVDLIYG
FT                   ARRSTVEIARADAARAAASGAAHVSAYALTLDPGIMAEEVPLARMRREGRLPLPSDDEV
FT                   AAQAAAIRAALRRAGLRRYEISNFARPGLESAHNRLYWTAESYLGLGAGAYGCARGEAG
FT                   SYRYGNLRDARAYLDAALGRRSPTAEEDRIAPAAERNERMMLGLRTLEGVPLATLSPIQ
FT                   SREADRLVRRRLAVRRRGALVLTSRGMDLHTSIAERLLE"
     MARRFGIYVH FPYCAHRCPY CDFAVTTERP PEGRRYLAAL LAELELRAGA FDGLAPVSVY        60
     LGGGTPSLWD PDEVAALLAA LRARLALPAG AEVTIEANPE STDRARLRAW RAAGVNRVSV       120
     GVQSFDAGVL AKLGRRHGPD AAERAIREAA EELGNVSVDL IYGARRSTVE IARADAARAA       180
     ASGAAHVSAY ALTLDPGIMA EEVPLARMRR EGRLPLPSDD EVAAQAAAIR AALRRAGLRR       240
     YEISNFARPG LESAHNRLYW TAESYLGLGA GAYGCARGEA GSYRYGNLRD ARAYLDAALG       300
     RRSPTAEEDR IAPAAERNER MMLGLRTLEG VPLATLSPIQ SREADRLVRR RLAVRRRGAL       360
     VLTSRGMDLH TSIAERLLE                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page