(data stored in ACNUC7421 zone)

EMBL: CP000769.PE263

CP000769.PE263       Location/Qualifiers
FT   CDS             complement(309813..310169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0265"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ade:Adeh_2901 cupin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24483"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y7"
FT                   /protein_id="ABS24483.1"
FT                   /translation="MARLVTTPFVVPAAGNPPKLIEELFGRVATGSAGVSVARMTSPPG
FT                   WAEPGQTPEFDEYTVVLEGALRVETREGVLEVGAGQAVHAPSGEWVRYSTPAGARYLAV
FT                   CVPAFSLDTVHRDG"
     MARLVTTPFV VPAAGNPPKL IEELFGRVAT GSAGVSVARM TSPPGWAEPG QTPEFDEYTV        60
     VLEGALRVET REGVLEVGAG QAVHAPSGEW VRYSTPAGAR YLAVCVPAFS LDTVHRDG         118
//

If you have problems or comments...

PBIL Back to PBIL home page