(data stored in ACNUC7421 zone)

EMBL: CP000769.PE265

CP000769.PE265       Location/Qualifiers
FT   CDS             312990..313850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0267"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   ade:Adeh_0246 ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24485"
FT                   /db_xref="GOA:A7H6Y9"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y9"
FT                   /protein_id="ABS24485.1"
FT                   /translation="MRPMPTFSLTLDAARERAEDLSAELFDAGASGVEVRDGEGTPMPG
FT                   IAQPAPGRALLVAFFSDRADAEEARAAHGGELAEVADEDWGETWKKGLGPLAVGRAFVR
FT                   PSWVDAPVPPGMAEIVLDPGMAFGTGTHPTTGLCLAALSELLAARPGASVLDVGTGSGL
FT                   LAIAAAKLGAGRVAANDNDPVAVAVARENADRNGAALELTGAAVGEIAGTFDLVVANIL
FT                   ANTLVELAPDVAARVAPGGTVLLAGILTPQEDEVRAAYVAQGLRPALERRDAEWSLLTL
FT                   ERPRA"
     MRPMPTFSLT LDAARERAED LSAELFDAGA SGVEVRDGEG TPMPGIAQPA PGRALLVAFF        60
     SDRADAEEAR AAHGGELAEV ADEDWGETWK KGLGPLAVGR AFVRPSWVDA PVPPGMAEIV       120
     LDPGMAFGTG THPTTGLCLA ALSELLAARP GASVLDVGTG SGLLAIAAAK LGAGRVAAND       180
     NDPVAVAVAR ENADRNGAAL ELTGAAVGEI AGTFDLVVAN ILANTLVELA PDVAARVAPG       240
     GTVLLAGILT PQEDEVRAAY VAQGLRPALE RRDAEWSLLT LERPRA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page