(data stored in ACNUC7421 zone)

EMBL: CP000769.PE267

CP000769.PE267       Location/Qualifiers
FT   CDS             314619..315572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0269"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   ade:Adeh_0248 RDD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24487"
FT                   /db_xref="GOA:A7H6Z1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z1"
FT                   /protein_id="ABS24487.1"
FT                   /translation="MLCPRCARETDERAAFCGACAAPLTLRDEPALRTLDVTLDLDRRR
FT                   SRTPPSLSSPSPTPPAAPARGAPPPEPAFVAPPAPAPASRSHWDLGRMVEEALRDAGVA
FT                   AEASAPAGAPAPAAQLAAPAAESAPFAWSDAAPQRWPDAAPEVIDADEAEVLGVAEVAV
FT                   RPAEVHLRRPATWRRAGAWAIDAGPLLAGVVYLGASLLAPTGSGAVAGLDGLLDLLARE
FT                   KDVVLSLVALLALALAVYATLAHALAGATLGKWMLGLRVVGPGGRRPSLARSAARSGLA
FT                   AASFALLGLGFLLALFTRSGRALHDLLARTWVVEAP"
     MLCPRCARET DERAAFCGAC AAPLTLRDEP ALRTLDVTLD LDRRRSRTPP SLSSPSPTPP        60
     AAPARGAPPP EPAFVAPPAP APASRSHWDL GRMVEEALRD AGVAAEASAP AGAPAPAAQL       120
     AAPAAESAPF AWSDAAPQRW PDAAPEVIDA DEAEVLGVAE VAVRPAEVHL RRPATWRRAG       180
     AWAIDAGPLL AGVVYLGASL LAPTGSGAVA GLDGLLDLLA REKDVVLSLV ALLALALAVY       240
     ATLAHALAGA TLGKWMLGLR VVGPGGRRPS LARSAARSGL AAASFALLGL GFLLALFTRS       300
     GRALHDLLAR TWVVEAP                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page