(data stored in ACNUC7421 zone)

EMBL: CP000769.PE268

CP000769.PE268       Location/Qualifiers
FT   CDS             315604..317637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0270"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: General secretory system II protein E domain
FT                   protein; KEGG: ade:Adeh_0249 PBS lyase heat-like repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24488"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z2"
FT                   /protein_id="ABS24488.1"
FT                   /translation="MPKDLAALLVEEGVVTADVMERALARRDEAGGALDTALLELGALP
FT                   EDALAIALAGAADVPPAPPEAFAGGDARARRVFPARVADRHGLAPFALDGRELSVVSVF
FT                   PVDAGLLDEIGFMLSLHLTAYVAPEWRVRLLVHQLYGTPIAPRFAAMAVAAGALAREDS
FT                   PGEADAAPGTEEREEGEAAPVGFGGDDEGPLEPLAAALAQALEEVDPGLVREALAPAGG
FT                   DAAAIRDAAPGAEEDVHAAPPDRSAPPGWTLEHARAALAAARTRDEVVLVALRYARDFF
FT                   AFAAMFAVTRDAVAGHDALGVEPEARELARGVAIYADDPGTFRTVIETKSPYLGPVSRE
FT                   PAGNAAILAGLDRGTPRTALVAPVLLRDRPVCVLFADNGGAPVSARRLGDLLLLVSTLG
FT                   AAFERIIRERKRRRAPARTLPPRAAQLAAEPAAAPPASDPWTAAAPGATPAPPAPAAAP
FT                   ADPWTATEPARPALAPAAAPAIPDELDALEIDVDESVVAPNTPPALLADRALDADPAVA
FT                   AAACAALAARRREPAAREASERLRRALLSGIEARARRAARALGALRDVDAIPLLVQVLE
FT                   TSAPEPARAAADALADITLQRLGTDARAWLGWWKQNRGRGRAEWLFSGLTSQERETRVA
FT                   AAVELSGVAPPPVAYSADLPPAERESAARAWAGWWSRSGNVL"
     MPKDLAALLV EEGVVTADVM ERALARRDEA GGALDTALLE LGALPEDALA IALAGAADVP        60
     PAPPEAFAGG DARARRVFPA RVADRHGLAP FALDGRELSV VSVFPVDAGL LDEIGFMLSL       120
     HLTAYVAPEW RVRLLVHQLY GTPIAPRFAA MAVAAGALAR EDSPGEADAA PGTEEREEGE       180
     AAPVGFGGDD EGPLEPLAAA LAQALEEVDP GLVREALAPA GGDAAAIRDA APGAEEDVHA       240
     APPDRSAPPG WTLEHARAAL AAARTRDEVV LVALRYARDF FAFAAMFAVT RDAVAGHDAL       300
     GVEPEARELA RGVAIYADDP GTFRTVIETK SPYLGPVSRE PAGNAAILAG LDRGTPRTAL       360
     VAPVLLRDRP VCVLFADNGG APVSARRLGD LLLLVSTLGA AFERIIRERK RRRAPARTLP       420
     PRAAQLAAEP AAAPPASDPW TAAAPGATPA PPAPAAAPAD PWTATEPARP ALAPAAAPAI       480
     PDELDALEID VDESVVAPNT PPALLADRAL DADPAVAAAA CAALAARRRE PAAREASERL       540
     RRALLSGIEA RARRAARALG ALRDVDAIPL LVQVLETSAP EPARAAADAL ADITLQRLGT       600
     DARAWLGWWK QNRGRGRAEW LFSGLTSQER ETRVAAAVEL SGVAPPPVAY SADLPPAERE       660
     SAARAWAGWW SRSGNVL                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page