(data stored in ACNUC7421 zone)

EMBL: CP000769.PE271

CP000769.PE271       Location/Qualifiers
FT   CDS             complement(320122..320325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0273"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ade:Adeh_0252 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24491"
FT                   /db_xref="GOA:A7H6Z5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z5"
FT                   /protein_id="ABS24491.1"
FT                   /translation="MATGTVKWFNDAKGFGFITQDNGGEDVFCHYSAIQGDGFKSLAEG
FT                   QKVEFDVVKGPKGLQAANVRKT"
     MATGTVKWFN DAKGFGFITQ DNGGEDVFCH YSAIQGDGFK SLAEGQKVEF DVVKGPKGLQ        60
     AANVRKT                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page