(data stored in ACNUC7421 zone)

EMBL: CP000769.PE278

CP000769.PE278       Location/Qualifiers
FT   CDS             327613..328125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0280"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: ade:Adeh_0258 biotin/lipoyl attachment
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24498"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A7H702"
FT                   /protein_id="ABS24498.1"
FT                   /translation="MSTYVALLDGGRREESIEVRQTGAGTFEVRLRGEVHVVDAYKHDY
FT                   GTLSLIVDTASYTATLDRRDAHVRVRVRDSVYPIEILDEKKLRIRRATARFTVDGRQIL
FT                   TAPMPGRIVRVLAKAGDAVKAGQGLVVVEALQMENEMKSPKDGKVLEVLVAEGQAVEAN
FT                   AKLCVVE"
     MSTYVALLDG GRREESIEVR QTGAGTFEVR LRGEVHVVDA YKHDYGTLSL IVDTASYTAT        60
     LDRRDAHVRV RVRDSVYPIE ILDEKKLRIR RATARFTVDG RQILTAPMPG RIVRVLAKAG       120
     DAVKAGQGLV VVEALQMENE MKSPKDGKVL EVLVAEGQAV EANAKLCVVE                  170
//

If you have problems or comments...

PBIL Back to PBIL home page