(data stored in ACNUC7421 zone)

EMBL: CP000769.PE286

CP000769.PE286       Location/Qualifiers
FT   CDS             complement(336021..336434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0289"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ade:Adeh_0267 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24506"
FT                   /db_xref="GOA:A7H710"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H710"
FT                   /protein_id="ABS24506.1"
FT                   /translation="MSMDVGSKSVKSDINVTPLVDVVLVLLIIFMVITPMLQRGKPVQL
FT                   PDAKHVSALKGGGDPVLLSITADGKAWIDKAEVPLDQLSTELTVAMQMSPGSPVMIKGD
FT                   KSLDYKKVREIILEVSKTHLLGVSLAASEIKEK"
     MSMDVGSKSV KSDINVTPLV DVVLVLLIIF MVITPMLQRG KPVQLPDAKH VSALKGGGDP        60
     VLLSITADGK AWIDKAEVPL DQLSTELTVA MQMSPGSPVM IKGDKSLDYK KVREIILEVS       120
     KTHLLGVSLA ASEIKEK                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page