(data stored in ACNUC7421 zone)

EMBL: CP000769.PE288

CP000769.PE288       Location/Qualifiers
FT   CDS             complement(337308..338051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24508"
FT                   /db_xref="GOA:A7H712"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A7H712"
FT                   /protein_id="ABS24508.1"
FT                   /translation="MFDEVTKKEGGKAAARRAGYVFGSTVFQGILIAAVIFASAAIKAK
FT                   VIDEPVVDVKFVKTAPPPPPPPPPPAPPAARKRPPESKPRTDLPKPPPPQALIQPQEIQ
FT                   PEMKAPDPNEAPEPEYDYGDVGEGEGVVGGVVGAQAANDIEDAPAYATAGYRKPQMKEP
FT                   GCVQRSVRIPQQLAGYISGPITVKFAIRPDGVPSRFEVMGTVPDQRISTSIWQAVQSCK
FT                   WVPGADAQGRPVAIWVILPIRFTSG"
     MFDEVTKKEG GKAAARRAGY VFGSTVFQGI LIAAVIFASA AIKAKVIDEP VVDVKFVKTA        60
     PPPPPPPPPP APPAARKRPP ESKPRTDLPK PPPPQALIQP QEIQPEMKAP DPNEAPEPEY       120
     DYGDVGEGEG VVGGVVGAQA ANDIEDAPAY ATAGYRKPQM KEPGCVQRSV RIPQQLAGYI       180
     SGPITVKFAI RPDGVPSRFE VMGTVPDQRI STSIWQAVQS CKWVPGADAQ GRPVAIWVIL       240
     PIRFTSG                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page