(data stored in ACNUC7421 zone)

EMBL: CP000769.PE291

CP000769.PE291       Location/Qualifiers
FT   CDS             complement(343799..344458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0294"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B dimerisation; KEGG:
FT                   ade:Adeh_0272 translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24511"
FT                   /db_xref="GOA:A7H715"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H715"
FT                   /protein_id="ABS24511.1"
FT                   /translation="MAEVNANMVKELREKTGAGMMDCKKALAEAGGDFAKAEEVLRKKG
FT                   LAAAAKKSSRAATEGQVASYIHMGGKIGVLVEVNCETDFVARTDGFQALVKDIAMQIAA
FT                   AAPQWVRRDEVPADVVAKELEIAKAQMRDQKKPEAILEKIAQGKLEKFYEQFCLLDQPF
FT                   VKEDKKKMSEVLTDAVAKIGENIQVRRFARFVLGEGLEKKQENLAEEVAKAAGLQK"
     MAEVNANMVK ELREKTGAGM MDCKKALAEA GGDFAKAEEV LRKKGLAAAA KKSSRAATEG        60
     QVASYIHMGG KIGVLVEVNC ETDFVARTDG FQALVKDIAM QIAAAAPQWV RRDEVPADVV       120
     AKELEIAKAQ MRDQKKPEAI LEKIAQGKLE KFYEQFCLLD QPFVKEDKKK MSEVLTDAVA       180
     KIGENIQVRR FARFVLGEGL EKKQENLAEE VAKAAGLQK                              219
//

If you have problems or comments...

PBIL Back to PBIL home page