(data stored in ACNUC7421 zone)

EMBL: CP000769.PE292

CP000769.PE292       Location/Qualifiers
FT   CDS             complement(344541..345488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0295"
FT                   /product="ribosomal protein S2"
FT                   /note="PFAM: ribosomal protein S2; KEGG: ade:Adeh_0273
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24512"
FT                   /db_xref="GOA:A7H716"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H716"
FT                   /protein_id="ABS24512.1"
FT                   /translation="MASALTTQGTAITMKQLLEAGVHFGHQTKRWNPKMKPYIFGARNG
FT                   IYIIDLQKTVGLARGALRFVSDAVAKGGMVLFVGTKKQAQDAIREEASRSGQYHVTNRW
FT                   LGGTLTNFKTVKQGIDRLKTIEKMAADGTYERLPKKEVAQLEREREKLEKNLGGIKEMS
FT                   RLPAAIFVIDTKKEHIAVHEANRLGIPVVAVVDTNCDPEGIEYVIPGNDDAIRSIRLFT
FT                   GKIAEACIEGRARYSTWAAQHGEERRPGEEDRDAASERGQKDRRDRRDRRGGGRDRERR
FT                   EPREDRAAASANVEVVRKGEVTPAQPAPGSDANR"
     MASALTTQGT AITMKQLLEA GVHFGHQTKR WNPKMKPYIF GARNGIYIID LQKTVGLARG        60
     ALRFVSDAVA KGGMVLFVGT KKQAQDAIRE EASRSGQYHV TNRWLGGTLT NFKTVKQGID       120
     RLKTIEKMAA DGTYERLPKK EVAQLERERE KLEKNLGGIK EMSRLPAAIF VIDTKKEHIA       180
     VHEANRLGIP VVAVVDTNCD PEGIEYVIPG NDDAIRSIRL FTGKIAEACI EGRARYSTWA       240
     AQHGEERRPG EEDRDAASER GQKDRRDRRD RRGGGRDRER REPREDRAAA SANVEVVRKG       300
     EVTPAQPAPG SDANR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page