(data stored in ACNUC7421 zone)

EMBL: CP000769.PE294

CP000769.PE294       Location/Qualifiers
FT   CDS             347568..348881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0298"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: ade:Adeh_0276
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24514"
FT                   /db_xref="GOA:A7H718"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H718"
FT                   /protein_id="ABS24514.1"
FT                   /translation="MPRKPLRPRPNRNDLVDPLVLEVHGLVRDQGWLADRALERALRRE
FT                   PKPWASERRAVAESVYGLIRWQGLLDFLLGGKPDLATRYAAWLVRFEGVPVADAARRLA
FT                   VPPAALAGLASAEARLAAVTEPVERLSLEASLPSWIAERFVRELGEVEARTLAAAMNAR
FT                   APLTVRANLLKIDREELRGKLGSEGMASEPTRFSPWGLVLDGHQNAFALGSFRDGLFEI
FT                   QDEGSQLIALACGARPGKTVVDACAGAGGKSLALAMEMRNKGSLHALDTDEGRLDDAKK
FT                   RARRAGVHNLRARVIAAGAEAEAQLADLAGQADVVLVDAPCSGLGTLRRKPDARWRLTP
FT                   EDPERFAGIQRTLVRRFAALLRPGGRLVYATCSVGKTENGDIADYAEREVGLAPVPLAP
FT                   LLGEERAKALGVDGARLELFPHRHGTDGFFVAAFEKRK"
     MPRKPLRPRP NRNDLVDPLV LEVHGLVRDQ GWLADRALER ALRREPKPWA SERRAVAESV        60
     YGLIRWQGLL DFLLGGKPDL ATRYAAWLVR FEGVPVADAA RRLAVPPAAL AGLASAEARL       120
     AAVTEPVERL SLEASLPSWI AERFVRELGE VEARTLAAAM NARAPLTVRA NLLKIDREEL       180
     RGKLGSEGMA SEPTRFSPWG LVLDGHQNAF ALGSFRDGLF EIQDEGSQLI ALACGARPGK       240
     TVVDACAGAG GKSLALAMEM RNKGSLHALD TDEGRLDDAK KRARRAGVHN LRARVIAAGA       300
     EAEAQLADLA GQADVVLVDA PCSGLGTLRR KPDARWRLTP EDPERFAGIQ RTLVRRFAAL       360
     LRPGGRLVYA TCSVGKTENG DIADYAEREV GLAPVPLAPL LGEERAKALG VDGARLELFP       420
     HRHGTDGFFV AAFEKRK                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page