(data stored in ACNUC7421 zone)

EMBL: CP000769.PE295

CP000769.PE295       Location/Qualifiers
FT   CDS             348884..349714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0299"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycolase; zinc finger Fpg domain
FT                   protein; KEGG: ade:Adeh_0277 DNA-formamidopyrimidine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24515"
FT                   /db_xref="GOA:A7H719"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A7H719"
FT                   /protein_id="ABS24515.1"
FT                   /translation="MPELPEVEIAARNLRRWTMGRRIERIEPDPKARYVFRPATPTAFA
FT                   RGLEGARFGPIRRIGKHLLVSMKKDGAPVGLLAHLGMTGKWLRREGDAAPSRFSRARFH
FT                   LDDGAVLHFDDMRLFGRLRVVPGARFEEVREIAELGPDPLEQGIDLDRLAEALGRSRLA
FT                   VKVRIMDQALLPGVGNIVASESLFLAKIDPRRQARSLTPAEVRKLADGILATVKETIAR
FT                   EDSPEISYVEEPGSENPFLVYAREGERCPRCRRAEIVRVVQAQRSTYYCPRCQR"
     MPELPEVEIA ARNLRRWTMG RRIERIEPDP KARYVFRPAT PTAFARGLEG ARFGPIRRIG        60
     KHLLVSMKKD GAPVGLLAHL GMTGKWLRRE GDAAPSRFSR ARFHLDDGAV LHFDDMRLFG       120
     RLRVVPGARF EEVREIAELG PDPLEQGIDL DRLAEALGRS RLAVKVRIMD QALLPGVGNI       180
     VASESLFLAK IDPRRQARSL TPAEVRKLAD GILATVKETI AREDSPEISY VEEPGSENPF       240
     LVYAREGERC PRCRRAEIVR VVQAQRSTYY CPRCQR                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page