(data stored in ACNUC7421 zone)

EMBL: CP000769.PE300

CP000769.PE300       Location/Qualifiers
FT   CDS             354714..355463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0304"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ade:Adeh_0280
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24520"
FT                   /db_xref="GOA:A7H724"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H724"
FT                   /protein_id="ABS24520.1"
FT                   /translation="MPSDRAATPKPSYKRILLKLSGEALMGDGKYGISPKTLSAIAGDV
FT                   KDCVDLGVEVALTIGGGNIFRGVSGATEGMDRSSADYMGMLATVINAMALQDALEKIGV
FT                   NTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPYFTTDTAASLRAMEIHAD
FT                   VLLKATKVDGVYTDDPKKNPAATKFKQLSYIDVLKKNLKVMDSTAISLCMDNDLPIIVF
FT                   DSTLRGNVRRVVLGEQIGTTVGRLEEK"
     MPSDRAATPK PSYKRILLKL SGEALMGDGK YGISPKTLSA IAGDVKDCVD LGVEVALTIG        60
     GGNIFRGVSG ATEGMDRSSA DYMGMLATVI NAMALQDALE KIGVNTRVQS AIEMHQVAEP       120
     YIRRRAIRHL EKGRVVIFAA GTGNPYFTTD TAASLRAMEI HADVLLKATK VDGVYTDDPK       180
     KNPAATKFKQ LSYIDVLKKN LKVMDSTAIS LCMDNDLPII VFDSTLRGNV RRVVLGEQIG       240
     TTVGRLEEK                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page