(data stored in ACNUC7421 zone)

EMBL: CP000769.PE302

CP000769.PE302       Location/Qualifiers
FT   CDS             356041..356238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24522"
FT                   /db_xref="GOA:A7H726"
FT                   /db_xref="UniProtKB/TrEMBL:A7H726"
FT                   /protein_id="ABS24522.1"
FT                   /translation="MRLPALLLLLGPLFVIGFGAGALRAWSHRPGVSDRTRRALQAVWV
FT                   LLLLGGTPLWLFLAATLGIF"
     MRLPALLLLL GPLFVIGFGA GALRAWSHRP GVSDRTRRAL QAVWVLLLLG GTPLWLFLAA        60
     TLGIF                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page