(data stored in ACNUC7421 zone)

EMBL: CP000769.PE305

CP000769.PE305       Location/Qualifiers
FT   CDS             complement(357135..358061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0309"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   mxa:MXAN_2651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24525"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H729"
FT                   /protein_id="ABS24525.1"
FT                   /translation="MTAAFGVACHAPSETPVAKTPEPPAVSLMRDEPLPALALSSGGRR
FT                   APPAAMPARRPRTADAALSYPVFAPGTLSLDDVDLSVKVDEDRYEQVIVDLQRRAYALQ
FT                   VRNFLDEGRAIVVFEGWDAAGKGGCIKRLTTLMDPRGYKVWPIGAPNEEERSYHWLWRF
FT                   WTRLPRRGELAVFDRSWYGRVLVERVEKLATGEEWRRAYDEINAFERTLTADGIRLLKF
FT                   FLHIDRKTQLERFRDREADPVKRYKLGPEDWRNRKAAPAYRRAIEDMLARTHRPDAPWL
FT                   LVAANDKKHARLEVLRATIRLLEGKTP"
     MTAAFGVACH APSETPVAKT PEPPAVSLMR DEPLPALALS SGGRRAPPAA MPARRPRTAD        60
     AALSYPVFAP GTLSLDDVDL SVKVDEDRYE QVIVDLQRRA YALQVRNFLD EGRAIVVFEG       120
     WDAAGKGGCI KRLTTLMDPR GYKVWPIGAP NEEERSYHWL WRFWTRLPRR GELAVFDRSW       180
     YGRVLVERVE KLATGEEWRR AYDEINAFER TLTADGIRLL KFFLHIDRKT QLERFRDREA       240
     DPVKRYKLGP EDWRNRKAAP AYRRAIEDML ARTHRPDAPW LLVAANDKKH ARLEVLRATI       300
     RLLEGKTP                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page