(data stored in ACNUC7421 zone)

EMBL: CP000769.PE316

CP000769.PE316       Location/Qualifiers
FT   CDS             complement(372129..372668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24536"
FT                   /db_xref="UniProtKB/TrEMBL:A7H740"
FT                   /protein_id="ABS24536.1"
FT                   /translation="MHVRTVVVVVAMATLARAGTARAAVSLGLEATLGAEQLGVQRAPG
FT                   SNEPLAQMGQLGGTVLLRVGSLAVGAAAGGYFDGSRLERYDASGLAGLAFDVLPLLRLE
FT                   LLGELGAASLRSREDLGAAVAGEWSTFYGARPGVSLKIPAFPLRLGVWGLARWGLPGTP
FT                   SGEPALGMLGRVGVEF"
     MHVRTVVVVV AMATLARAGT ARAAVSLGLE ATLGAEQLGV QRAPGSNEPL AQMGQLGGTV        60
     LLRVGSLAVG AAAGGYFDGS RLERYDASGL AGLAFDVLPL LRLELLGELG AASLRSREDL       120
     GAAVAGEWST FYGARPGVSL KIPAFPLRLG VWGLARWGLP GTPSGEPALG MLGRVGVEF        179
//

If you have problems or comments...

PBIL Back to PBIL home page