(data stored in ACNUC7421 zone)

EMBL: CP000769.PE321

CP000769.PE321       Location/Qualifiers
FT   CDS             377638..378036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0326"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   reu:Reut_A0176 protein of unknown function DUF606"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24541"
FT                   /db_xref="GOA:A7H745"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A7H745"
FT                   /protein_id="ABS24541.1"
FT                   /translation="MVPVQAGVNATLARHAGRPEWAAFVSFAVGLAGLAAYVVVLRVRP
FT                   PPLAALAAAPPWSWTGGLLGAFYVTAIVILTPRIGFTLALALTLAGQMIAALALDHAGA
FT                   LGLATRPVTAPRLVGAALLFAGVLLMRR"
     MVPVQAGVNA TLARHAGRPE WAAFVSFAVG LAGLAAYVVV LRVRPPPLAA LAAAPPWSWT        60
     GGLLGAFYVT AIVILTPRIG FTLALALTLA GQMIAALALD HAGALGLATR PVTAPRLVGA       120
     ALLFAGVLLM RR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page