(data stored in ACNUC7421 zone)

EMBL: CP000769.PE327

CP000769.PE327       Location/Qualifiers
FT   CDS             complement(385218..386969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0332"
FT                   /product="oligopeptide transporters, OPT superfamily"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   PFAM: Oligopeptide transporter OPT superfamily protein;
FT                   KEGG: ade:Adeh_4092 oligopeptide transporter, OPT
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24547"
FT                   /db_xref="GOA:A7H751"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A7H751"
FT                   /protein_id="ABS24547.1"
FT                   /translation="MRELSPSTDLPNLVAPKRELTARAVAIAILVAALMGAAEPTVVLR
FT                   IGYGPNMSVVSAFLGFIVITLIGKLTGRRGTRFENNLVQTAGTAAASGVGFMAVVLAAI
FT                   DMLNQRGLMNLHLSSLQIFAWLAPSGLLGVLLAVPLRKHYIDQENLPFADGTAAGETLL
FT                   VLDEGPKQAGPRVAALGIGGAISVGFTVLRQGFKWIPDTIAFGFLTPHAEALRLGSEVG
FT                   VLSLGAGILVGLRVTLSMGLGMLLGWIVAPDRLFARGLVPELTFNAILQRWIMWPATGL
FT                   MVAGGLTALVLKWKVIAKTFHGLSGKEADTSGDFPMRWVVWGALGCAVVLAAVQKISLG
FT                   FPIWLSAVSVLLSIVLMLVGIRVLGETNWAPISAMANVMQAVFAVLAPGHVPINMVGSG
FT                   MSGAVAANGEHLMQDYRAGKIVGSTNRHLTYLQLIGVPIGAAAVAVAYPAVRAKYGIGG
FT                   EGGLTSPISVKWAGFAELLSQGFGALPSSALVALVVALVAGVVLTLLEASPRFGRYVPS
FT                   PTAIGLGALIPGFAVVPMVIGGVAQDLWRRLSPRTEDVYATPLASGFITGEALVLLFLA
FT                   LWAAVAG"
     MRELSPSTDL PNLVAPKREL TARAVAIAIL VAALMGAAEP TVVLRIGYGP NMSVVSAFLG        60
     FIVITLIGKL TGRRGTRFEN NLVQTAGTAA ASGVGFMAVV LAAIDMLNQR GLMNLHLSSL       120
     QIFAWLAPSG LLGVLLAVPL RKHYIDQENL PFADGTAAGE TLLVLDEGPK QAGPRVAALG       180
     IGGAISVGFT VLRQGFKWIP DTIAFGFLTP HAEALRLGSE VGVLSLGAGI LVGLRVTLSM       240
     GLGMLLGWIV APDRLFARGL VPELTFNAIL QRWIMWPATG LMVAGGLTAL VLKWKVIAKT       300
     FHGLSGKEAD TSGDFPMRWV VWGALGCAVV LAAVQKISLG FPIWLSAVSV LLSIVLMLVG       360
     IRVLGETNWA PISAMANVMQ AVFAVLAPGH VPINMVGSGM SGAVAANGEH LMQDYRAGKI       420
     VGSTNRHLTY LQLIGVPIGA AAVAVAYPAV RAKYGIGGEG GLTSPISVKW AGFAELLSQG       480
     FGALPSSALV ALVVALVAGV VLTLLEASPR FGRYVPSPTA IGLGALIPGF AVVPMVIGGV       540
     AQDLWRRLSP RTEDVYATPL ASGFITGEAL VLLFLALWAA VAG                         583
//

If you have problems or comments...

PBIL Back to PBIL home page