(data stored in ACNUC7421 zone)

EMBL: CP000769.PE341

CP000769.PE341       Location/Qualifiers
FT   CDS             complement(400725..401264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0346"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ade:Adeh_4077 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24561"
FT                   /db_xref="GOA:A7H765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H765"
FT                   /protein_id="ABS24561.1"
FT                   /translation="MKTALDALSIWAIPLLLAGVPAVALARGVKVYPAFVDGAKQGFET
FT                   AVRIIPSLVAILVALGMLRASGAMDSFAALLAPLSEAAGVPASVVPLVLVRPLSGGGAL
FT                   GVVADVLRAEGPDGYAGRLVSVMAGSTETTFYVLAVYFGAIGVSRYRHALPAALLADLA
FT                   GFAAAVVAVRLVFGAG"
     MKTALDALSI WAIPLLLAGV PAVALARGVK VYPAFVDGAK QGFETAVRII PSLVAILVAL        60
     GMLRASGAMD SFAALLAPLS EAAGVPASVV PLVLVRPLSG GGALGVVADV LRAEGPDGYA       120
     GRLVSVMAGS TETTFYVLAV YFGAIGVSRY RHALPAALLA DLAGFAAAVV AVRLVFGAG        179
//

If you have problems or comments...

PBIL Back to PBIL home page