(data stored in ACNUC7421 zone)

EMBL: CP000769.PE342

CP000769.PE342       Location/Qualifiers
FT   CDS             complement(401485..402090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0347"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ade:Adeh_4076 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24562"
FT                   /db_xref="GOA:A7H766"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A7H766"
FT                   /protein_id="ABS24562.1"
FT                   /translation="MGVIWTVLVAVAVVAAAVNGRMAALTPAAMESAGKAVTLSIGLAG
FT                   AMALWLGLMRVAEEAGLVRALARAARPVMRRLFPEVPPEHPAMGAMLMNLSANLLGLGN
FT                   AVTPFGVKAMQALETLNPRPGTASNAQALFCAMNTASVQLVPASVIALRAAAGSRAPAE
FT                   ILGATILASVCGATAAILTAKLLARATPEAAPAEGEPC"
     MGVIWTVLVA VAVVAAAVNG RMAALTPAAM ESAGKAVTLS IGLAGAMALW LGLMRVAEEA        60
     GLVRALARAA RPVMRRLFPE VPPEHPAMGA MLMNLSANLL GLGNAVTPFG VKAMQALETL       120
     NPRPGTASNA QALFCAMNTA SVQLVPASVI ALRAAAGSRA PAEILGATIL ASVCGATAAI       180
     LTAKLLARAT PEAAPAEGEP C                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page