(data stored in ACNUC7421 zone)

EMBL: CP000769.PE344

CP000769.PE344       Location/Qualifiers
FT   CDS             403805..404209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0349"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ade:Adeh_4074
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24564"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A7H768"
FT                   /protein_id="ABS24564.1"
FT                   /translation="MNGLDHVAILVADLDAAIRLYRDVYGLELAEVEEVPTEKVRVAIF
FT                   GHGAGRIELVSPSGPDSPMAKAIEKRGEGLHHVCLEVPDIEQAMAALRAQGAPLLDEKP
FT                   RPGAGGSKVAFVHPKGSRGVLVELKQGGGY"
     MNGLDHVAIL VADLDAAIRL YRDVYGLELA EVEEVPTEKV RVAIFGHGAG RIELVSPSGP        60
     DSPMAKAIEK RGEGLHHVCL EVPDIEQAMA ALRAQGAPLL DEKPRPGAGG SKVAFVHPKG       120
     SRGVLVELKQ GGGY                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page