(data stored in ACNUC7421 zone)

EMBL: CP000769.PE353

CP000769.PE353       Location/Qualifiers
FT   CDS             413009..413872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0358"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   mxa:MXAN_5924 TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24573"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A7H777"
FT                   /protein_id="ABS24573.1"
FT                   /translation="MTPLRALLTLSLATALAGCEREPKTIVAAPADPPRSTRAPAEPAD
FT                   APPPAPGAPDGARGAPMTPAPGAPGQGLPSSAELLAQVEAMKGQLASAPKSLEILLALG
FT                   NLYFQERRYPDAIGWYDQAVALAEPVWKDYLALPAAAREKEPAAAVKQACTRTEQRGFE
FT                   ALAKEASARARKKDVAGAGYCYRAALEPSIGVRIQRANARLLGGDERGAIADHEALLAR
FT                   VPDQPDALYFLGLALAETARGDVAQLERARALWKRVAELQPNGPYADDLKLATAEVERR
FT                   IAAARR"
     MTPLRALLTL SLATALAGCE REPKTIVAAP ADPPRSTRAP AEPADAPPPA PGAPDGARGA        60
     PMTPAPGAPG QGLPSSAELL AQVEAMKGQL ASAPKSLEIL LALGNLYFQE RRYPDAIGWY       120
     DQAVALAEPV WKDYLALPAA AREKEPAAAV KQACTRTEQR GFEALAKEAS ARARKKDVAG       180
     AGYCYRAALE PSIGVRIQRA NARLLGGDER GAIADHEALL ARVPDQPDAL YFLGLALAET       240
     ARGDVAQLER ARALWKRVAE LQPNGPYADD LKLATAEVER RIAAARR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page