(data stored in ACNUC7421 zone)

EMBL: CP000769.PE354

CP000769.PE354       Location/Qualifiers
FT   CDS             414062..414667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0359"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ade:Adeh_3380 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24574"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A7H778"
FT                   /protein_id="ABS24574.1"
FT                   /translation="MPKLYYVPRTRAARPRIVLEELGIPYELVRLDPGSGETRTPEHLA
FT                   RHPLGHVPVLEDGEVRLFESGAICFWLAERYGEGRLLAPPGSPARALAYQWLCFALSEL
FT                   EPPLAPLAAELKKPEPERDRARVEEGRARFHAAARAVDAALPGREFLLGSELSVADVVV
FT                   AAVLSYGKFLAGLEGLPAAEAYVLRLRSRPAWKRAMAD"
     MPKLYYVPRT RAARPRIVLE ELGIPYELVR LDPGSGETRT PEHLARHPLG HVPVLEDGEV        60
     RLFESGAICF WLAERYGEGR LLAPPGSPAR ALAYQWLCFA LSELEPPLAP LAAELKKPEP       120
     ERDRARVEEG RARFHAAARA VDAALPGREF LLGSELSVAD VVVAAVLSYG KFLAGLEGLP       180
     AAEAYVLRLR SRPAWKRAMA D                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page