(data stored in ACNUC7421 zone)

EMBL: CP000769.PE356

CP000769.PE356       Location/Qualifiers
FT   CDS             415392..416054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24576"
FT                   /db_xref="GOA:A7H780"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:A7H780"
FT                   /protein_id="ABS24576.1"
FT                   /translation="MHVASARSSQPSPVEKTGSARAGRAALVAALLALALSAVGPKDRL
FT                   TWLMEVAPVLVAVPVLVATRRVFPLTPLLYVLLAVHAAILCLGGHYTYAEVPLGFWVRD
FT                   ALGLARNHYDRLGHLAQGFVPALVAREVLLRTSPLRQGRWLFVLVTAVALAISALYEFV
FT                   EWGAALALGQSADAFLGTQGDPWDTQWDMFLAFLGAMAAQLALGRAQDRQLERLGRR"
     MHVASARSSQ PSPVEKTGSA RAGRAALVAA LLALALSAVG PKDRLTWLME VAPVLVAVPV        60
     LVATRRVFPL TPLLYVLLAV HAAILCLGGH YTYAEVPLGF WVRDALGLAR NHYDRLGHLA       120
     QGFVPALVAR EVLLRTSPLR QGRWLFVLVT AVALAISALY EFVEWGAALA LGQSADAFLG       180
     TQGDPWDTQW DMFLAFLGAM AAQLALGRAQ DRQLERLGRR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page