(data stored in ACNUC7421 zone)

EMBL: CP000769.PE357

CP000769.PE357       Location/Qualifiers
FT   CDS             complement(416051..416776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0362"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: ade:Adeh_4065 class II aldolase/adducin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24577"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A7H781"
FT                   /protein_id="ABS24577.1"
FT                   /translation="MSPRRRAALSSRRTKARGSPRAARVPAVSGERALRDAIVETCRRL
FT                   HARDLIGAGEGNVSARLGEDRFLVTPSGANKGYLAPADLVVVDGRGAVVSGEGRASTEL
FT                   RMHLAAYAARADVAAVVHAHPITAVALTVAGLPPPNDLVPEAAVTLGEIAVAPFATPGT
FT                   DEVPGSLAPLWAGHDVVLLERHGALALGRSLGEAFDRMETLERVARVALVARLAGRCEP
FT                   LSAEAIAKVLAAAGKPARG"
     MSPRRRAALS SRRTKARGSP RAARVPAVSG ERALRDAIVE TCRRLHARDL IGAGEGNVSA        60
     RLGEDRFLVT PSGANKGYLA PADLVVVDGR GAVVSGEGRA STELRMHLAA YAARADVAAV       120
     VHAHPITAVA LTVAGLPPPN DLVPEAAVTL GEIAVAPFAT PGTDEVPGSL APLWAGHDVV       180
     LLERHGALAL GRSLGEAFDR METLERVARV ALVARLAGRC EPLSAEAIAK VLAAAGKPAR       240
     G                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page