(data stored in ACNUC7421 zone)

EMBL: CP000769.PE358

CP000769.PE358       Location/Qualifiers
FT   CDS             complement(416773..417807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0363"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS); KEGG:
FT                   ade:Adeh_4064 KpsF/GutQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24578"
FT                   /db_xref="GOA:A7H782"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A7H782"
FT                   /protein_id="ABS24578.1"
FT                   /translation="MASRPKARVVRLPRARAKPRSARGDRPLLEYGRTVLDAESRAIAA
FT                   VRLDERFAEAVRWVLDCRGRVIVTGMGKPGFVAQKISATLASTGTPSHYVHPAEAAHGD
FT                   LGRITRDDVVIALSNSGETEELLRLLPALKKIGARVVAVTRDRVNPLARAADLALVIGD
FT                   VAEACPMGLAPTASTAVLLAVGDALAMTVLANRPFEKEEYALFHPGGKLGRGLMKVREL
FT                   MRGAESNPVVREDQPLSAAVARMTETPGRPGATSVVDAAGKLVGIFTDGDLRRLVEHGE
FT                   TDFTRPVSAAMGRNPRTVRPDALVVDAARVLRQARIDQVPVVDDEGRPVGLLDVQDLLA
FT                   AKIL"
     MASRPKARVV RLPRARAKPR SARGDRPLLE YGRTVLDAES RAIAAVRLDE RFAEAVRWVL        60
     DCRGRVIVTG MGKPGFVAQK ISATLASTGT PSHYVHPAEA AHGDLGRITR DDVVIALSNS       120
     GETEELLRLL PALKKIGARV VAVTRDRVNP LARAADLALV IGDVAEACPM GLAPTASTAV       180
     LLAVGDALAM TVLANRPFEK EEYALFHPGG KLGRGLMKVR ELMRGAESNP VVREDQPLSA       240
     AVARMTETPG RPGATSVVDA AGKLVGIFTD GDLRRLVEHG ETDFTRPVSA AMGRNPRTVR       300
     PDALVVDAAR VLRQARIDQV PVVDDEGRPV GLLDVQDLLA AKIL                        344
//

If you have problems or comments...

PBIL Back to PBIL home page