(data stored in ACNUC7421 zone)

EMBL: CP000769.PE361

CP000769.PE361       Location/Qualifiers
FT   CDS             complement(419451..420350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0366"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: PGAP1 family protein; KEGG: ade:Adeh_4060
FT                   alpha/beta hydrolase fold acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24581"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H785"
FT                   /protein_id="ABS24581.1"
FT                   /translation="MPGAPPCRRPKGALHCWREVLRMKVLRVIRRAARRVDEIAAALEL
FT                   PGTQDRIEKRTDFSRCPRPVLLLHGFFASRRTFDILEARLRRDGYGVFSLHLGGFGGTF
FT                   NTRGIDDVADLVRAKIERIYARNPGMGPLTIVGHSKGGLVAAYYVKRLGGWRRTRAVVT
FT                   LGTPHHGTPLAYLGLPLGGVSRSVWQMMPGSAFLERLRDGPWPAQVRLASIWSRRDGWA
FT                   PYPSAVLDTHGLPHLVNVEVRGEHRSFLTSKRVYQAILREIRTGEDQAPLVRGPLTAMR
FT                   GGRAAENGARAVSGSDAA"
     MPGAPPCRRP KGALHCWREV LRMKVLRVIR RAARRVDEIA AALELPGTQD RIEKRTDFSR        60
     CPRPVLLLHG FFASRRTFDI LEARLRRDGY GVFSLHLGGF GGTFNTRGID DVADLVRAKI       120
     ERIYARNPGM GPLTIVGHSK GGLVAAYYVK RLGGWRRTRA VVTLGTPHHG TPLAYLGLPL       180
     GGVSRSVWQM MPGSAFLERL RDGPWPAQVR LASIWSRRDG WAPYPSAVLD THGLPHLVNV       240
     EVRGEHRSFL TSKRVYQAIL REIRTGEDQA PLVRGPLTAM RGGRAAENGA RAVSGSDAA        299
//

If you have problems or comments...

PBIL Back to PBIL home page