(data stored in ACNUC7421 zone)

EMBL: CP000769.PE364

CP000769.PE364       Location/Qualifiers
FT   CDS             422588..422800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24584"
FT                   /db_xref="UniProtKB/TrEMBL:A7H788"
FT                   /protein_id="ABS24584.1"
FT                   /translation="MRHALQEPAGEDPRDLRLPNGCILCGGDLDVRVSDGEARSFCARC
FT                   RWISRPHMQRHADGIHVVHPAGGLA"
     MRHALQEPAG EDPRDLRLPN GCILCGGDLD VRVSDGEARS FCARCRWISR PHMQRHADGI        60
     HVVHPAGGLA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page