(data stored in ACNUC7421 zone)

EMBL: CP000769.PE365

CP000769.PE365       Location/Qualifiers
FT   CDS             complement(422820..423662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0370"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain; KEGG: ade:Adeh_4058
FT                   tryptophan synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24585"
FT                   /db_xref="GOA:A7H789"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A7H789"
FT                   /protein_id="ABS24585.1"
FT                   /translation="MKTAKASAPAAAAPPTDRIAAAFARCRARGEAALVTYVMGGDPDL
FT                   ATSRAMALACVEGGADLLELGVPFSDPMADGPTIQHAAERALASGTTPDGVLEVAAAVR
FT                   ARSDVPIALMGYLNPILARGVDRFAQGCARAGVDAVIVPDLLPEEAGDVAPVLAARGIR
FT                   TVFLLAPTSDAARVEAAARAATGFLYFVSVTGVTGARRAVAAEIAPAVAAIRAKSPVPV
FT                   VIGFGVSSPAQARELGPLADGVVVGSAIVQRVAEGGSRAARGARVTRFVRSLKRALRR"
     MKTAKASAPA AAAPPTDRIA AAFARCRARG EAALVTYVMG GDPDLATSRA MALACVEGGA        60
     DLLELGVPFS DPMADGPTIQ HAAERALASG TTPDGVLEVA AAVRARSDVP IALMGYLNPI       120
     LARGVDRFAQ GCARAGVDAV IVPDLLPEEA GDVAPVLAAR GIRTVFLLAP TSDAARVEAA       180
     ARAATGFLYF VSVTGVTGAR RAVAAEIAPA VAAIRAKSPV PVVIGFGVSS PAQARELGPL       240
     ADGVVVGSAI VQRVAEGGSR AARGARVTRF VRSLKRALRR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page