(data stored in ACNUC7421 zone)

EMBL: CP000769.PE366

CP000769.PE366       Location/Qualifiers
FT   CDS             complement(423659..424939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0371"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: ade:Adeh_4057 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24586"
FT                   /db_xref="GOA:A7H790"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A7H790"
FT                   /protein_id="ABS24586.1"
FT                   /translation="MTVPLPDPRGRFGAYGGRYVPETLVPALEELEAAWRAAREDPAFE
FT                   AELAELLTRFAGRETPLGEARRMSADAGGCRILLKREDLCHTGAHKVNNTLGQVLLARR
FT                   MGKTRIIAETGAGQHGVATATAAALFGLPCDVFMGALDVERQALNVFRMQLLGARVVPV
FT                   ESGSRTLKDAMNEALRDWVTNVRDTHYIIGSVAGPHPYPALVRDFQSVIGAEARRQCLE
FT                   VAGRLPDAVVACVGGGSNAMGIFSAFLEDPGVTLVAVEAAGHGLATGRHGASLAKGRPG
FT                   VLHGSRSYVLQDEHGQIREAHSISAGLDYPGVGPELAHLNDSGRLTLMQASDDDALEAL
FT                   QYLARMEGIIPALETAHAVAAARQVARALGPEGLLVVNVSGRGDKDVDQVRRALAARAA
FT                   PGRKAAPRRRARRPAPAAAPRRKRSGR"
     MTVPLPDPRG RFGAYGGRYV PETLVPALEE LEAAWRAARE DPAFEAELAE LLTRFAGRET        60
     PLGEARRMSA DAGGCRILLK REDLCHTGAH KVNNTLGQVL LARRMGKTRI IAETGAGQHG       120
     VATATAAALF GLPCDVFMGA LDVERQALNV FRMQLLGARV VPVESGSRTL KDAMNEALRD       180
     WVTNVRDTHY IIGSVAGPHP YPALVRDFQS VIGAEARRQC LEVAGRLPDA VVACVGGGSN       240
     AMGIFSAFLE DPGVTLVAVE AAGHGLATGR HGASLAKGRP GVLHGSRSYV LQDEHGQIRE       300
     AHSISAGLDY PGVGPELAHL NDSGRLTLMQ ASDDDALEAL QYLARMEGII PALETAHAVA       360
     AARQVARALG PEGLLVVNVS GRGDKDVDQV RRALAARAAP GRKAAPRRRA RRPAPAAAPR       420
     RKRSGR                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page