(data stored in ACNUC7421 zone)

EMBL: CP000769.PE37

CP000769.PE37        Location/Qualifiers
FT   CDS             50644..51876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24257"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B1"
FT                   /protein_id="ABS24257.1"
FT                   /translation="MTRTAPMLAALLLASPLAARAEEPQKLTLDTSGWIILNTYASSGA
FT                   LNANDLPRFAKAGSADEAALGMGVRQSRLRVNAGIPSDGLLFDAKLKAFVELDFMGGNA
FT                   VGSDDPSLPLVRLRHAWVSAAWPQRGNLSVLAGQTWGIVGGPYFAQSISHLAVPRFAGA
FT                   GFLYRRAPQVRVSGELGRAFGVTYQAGALAPIDRAGVTADAASGAPGPVGERSGLPNLE
FT                   ARVAGVYRPEGKTRAELGVSGHYGWEKYSFAATETRAADDFTAHSSAVALDLKLELPYV
FT                   QLVGGAFSGENLDILYAVNAKGVVPDAAAARVANVETRGLWGQAAVTPVAGYTLLLGAG
FT                   LEDPRDATLPAASASPILRNVQYSAGALVNLTSKWRVGFEVTRYVTDTATPAGHDTFTG
FT                   NQFELSTLLAL"
     MTRTAPMLAA LLLASPLAAR AEEPQKLTLD TSGWIILNTY ASSGALNAND LPRFAKAGSA        60
     DEAALGMGVR QSRLRVNAGI PSDGLLFDAK LKAFVELDFM GGNAVGSDDP SLPLVRLRHA       120
     WVSAAWPQRG NLSVLAGQTW GIVGGPYFAQ SISHLAVPRF AGAGFLYRRA PQVRVSGELG       180
     RAFGVTYQAG ALAPIDRAGV TADAASGAPG PVGERSGLPN LEARVAGVYR PEGKTRAELG       240
     VSGHYGWEKY SFAATETRAA DDFTAHSSAV ALDLKLELPY VQLVGGAFSG ENLDILYAVN       300
     AKGVVPDAAA ARVANVETRG LWGQAAVTPV AGYTLLLGAG LEDPRDATLP AASASPILRN       360
     VQYSAGALVN LTSKWRVGFE VTRYVTDTAT PAGHDTFTGN QFELSTLLAL                  410
//

If you have problems or comments...

PBIL Back to PBIL home page