(data stored in ACNUC7421 zone)

EMBL: CP000769.PE371

CP000769.PE371       Location/Qualifiers
FT   CDS             complement(428232..429713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0376"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein; Anthranilate synthase component I domain protein;
FT                   KEGG: ade:Adeh_4052 anthranilate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24591"
FT                   /db_xref="GOA:A7H795"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A7H795"
FT                   /protein_id="ABS24591.1"
FT                   /translation="MPVRVEVDADTETPVSAFLKLSRGERQAFLLESVEGGERSARFSF
FT                   LGAGPKSVLRHKLGDRGDPLAAVRAALATHTAVRVPGTPRFAGGLVGHVGYDAVKLFEP
FT                   RVPIANPDELGFPDLLLMDFDEVVAFDNRRHSLHVICEVRCDEGDDPRALYARAVKRIR
FT                   ARLALLAAPLEDRRARRAAKPSELVPRVAKPDYLAAVERAKDYVRAGDCQQIVLSQRFD
FT                   AEVSVPPFEIYRALRRVNPSPYLFFLKDGERALVGSSPETLIKLEDGEVTLRPIAGTRK
FT                   RGGDAAEDARLEAELRADPKENAEHVMLVDLGRNDVGRVSAVGSVRVTALKTVERYSHV
FT                   MHLVSEVKGRLAAGLGAVDVLRAGFPAGTVSGSPKVRAMEIIDELEPARRGPYAGAVGY
FT                   FDRGGDMEMCIAIRTLMARGRRVSVQAGGGLVYDSDPEAEYQETLNKARAVFTAVAQAE
FT                   SRVLDAVARPPAPAARTVAARTPKASRRRPRRGER"
     MPVRVEVDAD TETPVSAFLK LSRGERQAFL LESVEGGERS ARFSFLGAGP KSVLRHKLGD        60
     RGDPLAAVRA ALATHTAVRV PGTPRFAGGL VGHVGYDAVK LFEPRVPIAN PDELGFPDLL       120
     LMDFDEVVAF DNRRHSLHVI CEVRCDEGDD PRALYARAVK RIRARLALLA APLEDRRARR       180
     AAKPSELVPR VAKPDYLAAV ERAKDYVRAG DCQQIVLSQR FDAEVSVPPF EIYRALRRVN       240
     PSPYLFFLKD GERALVGSSP ETLIKLEDGE VTLRPIAGTR KRGGDAAEDA RLEAELRADP       300
     KENAEHVMLV DLGRNDVGRV SAVGSVRVTA LKTVERYSHV MHLVSEVKGR LAAGLGAVDV       360
     LRAGFPAGTV SGSPKVRAME IIDELEPARR GPYAGAVGYF DRGGDMEMCI AIRTLMARGR       420
     RVSVQAGGGL VYDSDPEAEY QETLNKARAV FTAVAQAESR VLDAVARPPA PAARTVAART       480
     PKASRRRPRR GER                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page