(data stored in ACNUC7421 zone)

EMBL: CP000769.PE378

CP000769.PE378       Location/Qualifiers
FT   CDS             436341..436577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0383"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: ade:Adeh_4046
FT                   SirA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24598"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A2"
FT                   /protein_id="ABS24598.1"
FT                   /translation="MPAPARTLDTSGRLCPFPIVETAKVVRTLEEGAVLLVISTDAGIA
FT                   TDMPMWCRATRNEHLGTFRDGAAWKSWVRKRAR"
     MPAPARTLDT SGRLCPFPIV ETAKVVRTLE EGAVLLVIST DAGIATDMPM WCRATRNEHL        60
     GTFRDGAAWK SWVRKRAR                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page