(data stored in ACNUC7421 zone)

EMBL: CP000769.PE379

CP000769.PE379       Location/Qualifiers
FT   CDS             436587..437642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0384"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="PFAM: thiamine biosynthesis protein; KEGG:
FT                   ade:Adeh_4045 thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24599"
FT                   /db_xref="GOA:A7H7A3"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A3"
FT                   /protein_id="ABS24599.1"
FT                   /translation="MPKQGKAIAMISGGLDSTLALALVRRQGVEVKAVTFYTGFCITET
FT                   QRRKGGRADGAVPRNEALRAAADLEVDIEYVDISGSEYLDMLVHPKYGYGANANPCVDC
FT                   RVFMMRKAKEIMEAEGADFIFTGEVLGQRPKSQRRDTLRIIERDSGLDGRLLRPLSAKL
FT                   LQPTIAEQEGIVDRERLEAISGRSRQRQMELARELGVVDWPQPAGGCCYLTDESFAKKF
FT                   FDVLDAREAAGEERRILPEDVVLLSTGRHFRLSPRAKLVVGRTEVENALLEHHVEGRAR
FT                   LEAQDVLGPVAIVEGEPTWEERVLASRIVARYGKGKDAPRVTVEWREGDLVERYEVEPE
FT                   QDEARVEALRI"
     MPKQGKAIAM ISGGLDSTLA LALVRRQGVE VKAVTFYTGF CITETQRRKG GRADGAVPRN        60
     EALRAAADLE VDIEYVDISG SEYLDMLVHP KYGYGANANP CVDCRVFMMR KAKEIMEAEG       120
     ADFIFTGEVL GQRPKSQRRD TLRIIERDSG LDGRLLRPLS AKLLQPTIAE QEGIVDRERL       180
     EAISGRSRQR QMELARELGV VDWPQPAGGC CYLTDESFAK KFFDVLDARE AAGEERRILP       240
     EDVVLLSTGR HFRLSPRAKL VVGRTEVENA LLEHHVEGRA RLEAQDVLGP VAIVEGEPTW       300
     EERVLASRIV ARYGKGKDAP RVTVEWREGD LVERYEVEPE QDEARVEALR I                351
//

If you have problems or comments...

PBIL Back to PBIL home page