(data stored in ACNUC7421 zone)

EMBL: CP000769.PE38

CP000769.PE38        Location/Qualifiers
FT   CDS             51936..52628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24258"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B2"
FT                   /protein_id="ABS24258.1"
FT                   /translation="MGSSRGRAGCVAALAAATVLLPACAGWKRDLVARTSSVIEPLVVR
FT                   CDAPPAPGAALRVASVTVEGELHPKAKVGSQFDWGRPFEEDPNLPDWLRLERKPLVVDA
FT                   DAFGRTLREDAQRLLAASGGEPPAGAHLFLRFEDVRTVAIPGRWNELRGRVLARVAFRA
FT                   ALRDAAGGRLWSGVFEGEAEDRVIYFRQVHHERMLSEAYCRALTRFGESLPVAARALAP
FT                   ARAPAGAP"
     MGSSRGRAGC VAALAAATVL LPACAGWKRD LVARTSSVIE PLVVRCDAPP APGAALRVAS        60
     VTVEGELHPK AKVGSQFDWG RPFEEDPNLP DWLRLERKPL VVDADAFGRT LREDAQRLLA       120
     ASGGEPPAGA HLFLRFEDVR TVAIPGRWNE LRGRVLARVA FRAALRDAAG GRLWSGVFEG       180
     EAEDRVIYFR QVHHERMLSE AYCRALTRFG ESLPVAARAL APARAPAGAP                  230
//

If you have problems or comments...

PBIL Back to PBIL home page