(data stored in ACNUC7421 zone)

EMBL: CP000769.PE380

CP000769.PE380       Location/Qualifiers
FT   CDS             437842..440796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0385"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="TIGRFAM: pyruvate, phosphate dikinase; PFAM:
FT                   PEP-utilizing protein; pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; PEP-utilising protein mobile region;
FT                   KEGG: ade:Adeh_4044 pyruvate, phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24600"
FT                   /db_xref="GOA:A7H7A4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A4"
FT                   /protein_id="ABS24600.1"
FT                   /translation="MAQKRIYAFGGGKAEGNKDMKELLGGKGAGLAEMSNIGIPVPPGF
FT                   TITTEVCTEYYRGGKKLPKGLEGELRAAMKRAEALAGKRFGDPKDPLLVSVRSGARASM
FT                   PGMMDTVLNLGLNDATVGGLARASGNPRFAWDSYRRFVAMFGDVVLGLKPEHKEDRDPF
FT                   EEILERKKLARGVRFDSELPEDALRELVTEFKAAIRERKGVEFPDDPYGQLLEAVAAVF
FT                   RSWDNDRAIAYRKLYGYPSDWGTAVSVQAMVFGNLGDDSGTGVAFTRNPATGDDAFYGE
FT                   FLVNAQGEDVVAGVRTPQKISELAARWPEIARQLESVRTKLEKHYQEMQDIEFTVERGK
FT                   LYVLQTRTGKRTGLAAVRIALDMAAERLITKEVALQRIEPEALNHLLRPIFDADRKAAA
FT                   MKAGKLLAKGLPAGPGAASGRVVFFAEDAVTWGARGERVILARHETSPEDIRGMATAEG
FT                   FLTAFGGMTSHAALVARQMGKVAIVGCEALSFDYHGRQMRVATAAGERVVREGDWISID
FT                   GTAAEVIEGELETRPSQVLQVLVEKTLAAEDAPVYREFAQVMAWADQARRLGVRANADQ
FT                   PDQAAVSVALGAQGIGLCRTEHMFFGEGKIGPMREMIVAETVEERRAALAKLLPLQRED
FT                   FRGIFEAMGPRPVTIRTIDPPLHEFLPQDEPGIAELARVTGKPVERIRARIEELHESNP
FT                   MLGHRGCRLGITYPEITEMQSRAIFEAACDVAERGIEVEPEVMIPLVGAKQELDDQAAV
FT                   VRRVADEVFAARGLAVSYHVGTMIEVPRGAVTAGEIAKTAEFFSFGTNDLTQTTFALSR
FT                   DDTGPVLATYLEKDIWPGDPFVSIDREGVGALMRMGVEGGRKTRPDLKLGICGEHGGDP
FT                   SSVEFCHELGLDYVSCSPYRLPIARLAAAQAALRERAAAPAKAAAKRVAKAAKASGGAA
FT                   GRAAKAARTPAQGGKRAKGLRDGKPAAARLGAALASKGLAKVKRALKARARRGR"
     MAQKRIYAFG GGKAEGNKDM KELLGGKGAG LAEMSNIGIP VPPGFTITTE VCTEYYRGGK        60
     KLPKGLEGEL RAAMKRAEAL AGKRFGDPKD PLLVSVRSGA RASMPGMMDT VLNLGLNDAT       120
     VGGLARASGN PRFAWDSYRR FVAMFGDVVL GLKPEHKEDR DPFEEILERK KLARGVRFDS       180
     ELPEDALREL VTEFKAAIRE RKGVEFPDDP YGQLLEAVAA VFRSWDNDRA IAYRKLYGYP       240
     SDWGTAVSVQ AMVFGNLGDD SGTGVAFTRN PATGDDAFYG EFLVNAQGED VVAGVRTPQK       300
     ISELAARWPE IARQLESVRT KLEKHYQEMQ DIEFTVERGK LYVLQTRTGK RTGLAAVRIA       360
     LDMAAERLIT KEVALQRIEP EALNHLLRPI FDADRKAAAM KAGKLLAKGL PAGPGAASGR       420
     VVFFAEDAVT WGARGERVIL ARHETSPEDI RGMATAEGFL TAFGGMTSHA ALVARQMGKV       480
     AIVGCEALSF DYHGRQMRVA TAAGERVVRE GDWISIDGTA AEVIEGELET RPSQVLQVLV       540
     EKTLAAEDAP VYREFAQVMA WADQARRLGV RANADQPDQA AVSVALGAQG IGLCRTEHMF       600
     FGEGKIGPMR EMIVAETVEE RRAALAKLLP LQREDFRGIF EAMGPRPVTI RTIDPPLHEF       660
     LPQDEPGIAE LARVTGKPVE RIRARIEELH ESNPMLGHRG CRLGITYPEI TEMQSRAIFE       720
     AACDVAERGI EVEPEVMIPL VGAKQELDDQ AAVVRRVADE VFAARGLAVS YHVGTMIEVP       780
     RGAVTAGEIA KTAEFFSFGT NDLTQTTFAL SRDDTGPVLA TYLEKDIWPG DPFVSIDREG       840
     VGALMRMGVE GGRKTRPDLK LGICGEHGGD PSSVEFCHEL GLDYVSCSPY RLPIARLAAA       900
     QAALRERAAA PAKAAAKRVA KAAKASGGAA GRAAKAARTP AQGGKRAKGL RDGKPAAARL       960
     GAALASKGLA KVKRALKARA RRGR                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page