(data stored in ACNUC7421 zone)

EMBL: CP000769.PE387

CP000769.PE387       Location/Qualifiers
FT   CDS             446866..447741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24607"
FT                   /db_xref="InterPro:IPR031823"
FT                   /db_xref="InterPro:IPR038537"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B1"
FT                   /protein_id="ABS24607.1"
FT                   /translation="MPSRRSLALAALALVAGASACRRPAETAPAPADARAAPGPFEAAL
FT                   AEGVRAFEERADPARLVEAISAFQRAAAARPGAVDAELPLARAQAFRALSAREPAEAKE
FT                   AWDASARAAERALRVTSPGWAQAIDRGEDPAAAAARVDPPGGEALYLLAQGAMRGAQAT
FT                   GYAAVLAVKDAALAMMARAAELDERIDAAGPHRALGAWRAALPVAAGGGADAARAHFDR
FT                   ARQLAPDDLLGRVAEAETYAVLVQDSALFDRLLAEVTGSDPASDPARAPENGVAQRRAI
FT                   ELRERRARLF"
     MPSRRSLALA ALALVAGASA CRRPAETAPA PADARAAPGP FEAALAEGVR AFEERADPAR        60
     LVEAISAFQR AAAARPGAVD AELPLARAQA FRALSAREPA EAKEAWDASA RAAERALRVT       120
     SPGWAQAIDR GEDPAAAAAR VDPPGGEALY LLAQGAMRGA QATGYAAVLA VKDAALAMMA       180
     RAAELDERID AAGPHRALGA WRAALPVAAG GGADAARAHF DRARQLAPDD LLGRVAEAET       240
     YAVLVQDSAL FDRLLAEVTG SDPASDPARA PENGVAQRRA IELRERRARL F                291
//

If you have problems or comments...

PBIL Back to PBIL home page