(data stored in ACNUC7421 zone)

EMBL: CP000769.PE388

CP000769.PE388       Location/Qualifiers
FT   CDS             447751..448668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24608"
FT                   /db_xref="InterPro:IPR025634"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B2"
FT                   /protein_id="ABS24608.1"
FT                   /translation="MVREPEAIAASPARRRRAAVLLAIASALVACRPRVPPPDLSRDAG
FT                   ELLAQVRAGQARVQRVSGEARVKVDAKGMRTAVTVRQFIAAEKPDRLHVEVLDFFGNVG
FT                   AVLAAEGGRFQLFDAKERVFYRGAATPENLARLVPLPLPAEDLVTILCGSAPLLDAAED
FT                   VEVRGAALVLSLGADGRAQEVRVGEQATVERSSVVAVGPGTAPAYSLDFDGFRPLAAGR
FT                   FPGELRIRAEDPRVRLDLRWGEVQVNGDLGGVRFTIDPPRGARVVELGDEEHEVPNLFR
FT                   EGVPEPAPGSSPAHGPGGAGSPSR"
     MVREPEAIAA SPARRRRAAV LLAIASALVA CRPRVPPPDL SRDAGELLAQ VRAGQARVQR        60
     VSGEARVKVD AKGMRTAVTV RQFIAAEKPD RLHVEVLDFF GNVGAVLAAE GGRFQLFDAK       120
     ERVFYRGAAT PENLARLVPL PLPAEDLVTI LCGSAPLLDA AEDVEVRGAA LVLSLGADGR       180
     AQEVRVGEQA TVERSSVVAV GPGTAPAYSL DFDGFRPLAA GRFPGELRIR AEDPRVRLDL       240
     RWGEVQVNGD LGGVRFTIDP PRGARVVELG DEEHEVPNLF REGVPEPAPG SSPAHGPGGA       300
     GSPSR                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page