(data stored in ACNUC7421 zone)

EMBL: CP000769.PE393

CP000769.PE393       Location/Qualifiers
FT   CDS             complement(451369..453690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24613"
FT                   /db_xref="GOA:A7H7B7"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B7"
FT                   /protein_id="ABS24613.1"
FT                   /translation="MRTRSVAVIAAVFLGAAALSLFVVLQLTRERPRAVPPAAPSAPSP
FT                   SVTPPLEPAATEADGRVELRATANDAPLAGAEVRLYLQLPPRTGALEPAWLRAAEARTD
FT                   AEGIARLPARPGTYLAAVRAAGLAPAHAEVFCAPGEELTHAEVALAQPTTLDVRVVARP
FT                   DGRPVQARIVLLPSVGRGARLAPPSAPVEERLSASADGAGAARVDGLAPGSYAVAAEAP
FT                   DLHPVLLPRVEVPRAEPLAISLEPLGRISGVVRDPSGRPAAGATVRGASRDHAASATSD
FT                   AEGRYTLAAPAGAYRLIAAAGEGAAGAGPVTVQAGATTEGIALALGRAAALEGVVVDER
FT                   SGRPVPGAEVALVLHDTGALAARAVASEEGRYRLAPLAPGQYDLRAAAAGRSPAVQRGV
FT                   TLAARQTFPLDVALAGTGTIEGAVADARGGPLAGARVRVEARGDGLAGALPLEARSDFE
FT                   GRYRIEGVEVGRAELVARQDGVALGVSRAVRVAPGSTARADFSLPEAGVLAGRVSQAGG
FT                   TAPVGTAVVAVPLKAGAGTPQRARAVADARGTYRLALPAGEYRVHAAPGDADRTDLRVA
FT                   PAFARVEAGATSRLDLTAAAPTAEEGVELVILEPGGAPSPGAAVTLARAGDDRIALATS
FT                   AGEDGRVVLAKEMGLAGASITVRARSGGRSGAWTGALPASGQVAVQLERGGAIAGAVRA
FT                   RGAEPRSVVVEVASRPSADGWRVTDVHRFPGARFELADVPTGPLRLTVRADDGRRGAAE
FT                   LSLASGETRTLEIPLEPDRR"
     MRTRSVAVIA AVFLGAAALS LFVVLQLTRE RPRAVPPAAP SAPSPSVTPP LEPAATEADG        60
     RVELRATAND APLAGAEVRL YLQLPPRTGA LEPAWLRAAE ARTDAEGIAR LPARPGTYLA       120
     AVRAAGLAPA HAEVFCAPGE ELTHAEVALA QPTTLDVRVV ARPDGRPVQA RIVLLPSVGR       180
     GARLAPPSAP VEERLSASAD GAGAARVDGL APGSYAVAAE APDLHPVLLP RVEVPRAEPL       240
     AISLEPLGRI SGVVRDPSGR PAAGATVRGA SRDHAASATS DAEGRYTLAA PAGAYRLIAA       300
     AGEGAAGAGP VTVQAGATTE GIALALGRAA ALEGVVVDER SGRPVPGAEV ALVLHDTGAL       360
     AARAVASEEG RYRLAPLAPG QYDLRAAAAG RSPAVQRGVT LAARQTFPLD VALAGTGTIE       420
     GAVADARGGP LAGARVRVEA RGDGLAGALP LEARSDFEGR YRIEGVEVGR AELVARQDGV       480
     ALGVSRAVRV APGSTARADF SLPEAGVLAG RVSQAGGTAP VGTAVVAVPL KAGAGTPQRA       540
     RAVADARGTY RLALPAGEYR VHAAPGDADR TDLRVAPAFA RVEAGATSRL DLTAAAPTAE       600
     EGVELVILEP GGAPSPGAAV TLARAGDDRI ALATSAGEDG RVVLAKEMGL AGASITVRAR       660
     SGGRSGAWTG ALPASGQVAV QLERGGAIAG AVRARGAEPR SVVVEVASRP SADGWRVTDV       720
     HRFPGARFEL ADVPTGPLRL TVRADDGRRG AAELSLASGE TRTLEIPLEP DRR              773
//

If you have problems or comments...

PBIL Back to PBIL home page