(data stored in ACNUC7421 zone)

EMBL: CP000769.PE395

CP000769.PE395       Location/Qualifiers
FT   CDS             complement(455159..455488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24615"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B9"
FT                   /protein_id="ABS24615.1"
FT                   /translation="MTSLSLRKLALAAALAVAVPSAALAMPCESERVPAPPRPTPAGWH
FT                   HESARERELREIRRELRALEDERADFHARYAGRPGKIRKFERWYASRRAELEARRDALR
FT                   YYAWR"
     MTSLSLRKLA LAAALAVAVP SAALAMPCES ERVPAPPRPT PAGWHHESAR ERELREIRRE        60
     LRALEDERAD FHARYAGRPG KIRKFERWYA SRRAELEARR DALRYYAWR                   109
//

If you have problems or comments...

PBIL Back to PBIL home page