(data stored in ACNUC7421 zone)

EMBL: CP000769.PE397

CP000769.PE397       Location/Qualifiers
FT   CDS             456000..456368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0402"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   ade:Adeh_4023 protein of unknown function DUF423"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24617"
FT                   /db_xref="GOA:A7H7C1"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C1"
FT                   /protein_id="ABS24617.1"
FT                   /translation="MERTFFALGAISAAVSVAAGAFGAHALKARLSPDLLAVFETGARY
FT                   EMYHALGLVAAAWAAARFGGAAPAWAGWLFLAGTVLFSGSLYALALTGVRGLGAVTPFG
FT                   GVAFIAGWLALAVSTLRR"
     MERTFFALGA ISAAVSVAAG AFGAHALKAR LSPDLLAVFE TGARYEMYHA LGLVAAAWAA        60
     ARFGGAAPAW AGWLFLAGTV LFSGSLYALA LTGVRGLGAV TPFGGVAFIA GWLALAVSTL       120
     RR                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page