(data stored in ACNUC7421 zone)

EMBL: CP000769.PE4

CP000769.PE4         Location/Qualifiers
FT   CDS             4373..6760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: ade:Adeh_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24224"
FT                   /db_xref="GOA:A7H678"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A7H678"
FT                   /protein_id="ABS24224.1"
FT                   /translation="MLEGLEAVRKRPHMYIGDVGERGLHHLVYEVVDNSVDEAMAGRAN
FT                   EITVTIHADSSITIVDNGSGIPIGPHPSVKGMDTLDVVLTKLHAGGKFESNAYKVSGGL
FT                   HGVGVTCVNALSEWLKAEVYREGKVWLQRYDRGTPAGKVTAVGETQRRGTKITFKPDAT
FT                   IFEVTEFSFETLSGRLRELAFLNAGLTITIEDERSGKKHEFLFKDGIREFVGYLNKSRD
FT                   VLFQPPISLRQEVETERGTALVEIALQWNDGYDEKVFAFANNIHNHEGGTHLIGFKAAL
FT                   TRTINAYGQKNNLFKDLKDELPSGDDMREGLAAVISIRLPGASFEGQTKTKLSNTEAKS
FT                   MVETMLNERLGAFLEENPNVAKRVCAKVAEATRARIAARKARETVRRKGALDGASLPGK
FT                   LADCQSRDPRESELFIVEGDSAGGSAKQGRDRRTQAILPLRGKILNVEKARFDKMLSSA
FT                   EIATMITALGTGIGPEEYDVSKIRYHKIVIMTDADVDGSHIRTLLLTFFFRQMPELVEK
FT                   GYLYIAQPPLYRVQKGKKESYLKDEAALDDFLLQLGTEKAKLVAGDLVVEGADLKRLAQ
FT                   DAIRYRGLLARVDRRRDSRIVDAAVQLGDLDLELLKHHEQVKEQVQKIFDKAQKLHPEL
FT                   EVRLAKIERDEEHGCDALVFQTTMSGATRTTRIDFDYLSGPEWGELAGLYGELAELGAG
FT                   PHKLRTGDGEEEVDDVFGAVEVLKRAATAGQTIQRYKGLGEMNPEQLWETTMDHARRTL
FT                   LQVRVDDTVEADEVFSVLMGDAVEPRREFIEKHALDVQNLDI"
     MLEGLEAVRK RPHMYIGDVG ERGLHHLVYE VVDNSVDEAM AGRANEITVT IHADSSITIV        60
     DNGSGIPIGP HPSVKGMDTL DVVLTKLHAG GKFESNAYKV SGGLHGVGVT CVNALSEWLK       120
     AEVYREGKVW LQRYDRGTPA GKVTAVGETQ RRGTKITFKP DATIFEVTEF SFETLSGRLR       180
     ELAFLNAGLT ITIEDERSGK KHEFLFKDGI REFVGYLNKS RDVLFQPPIS LRQEVETERG       240
     TALVEIALQW NDGYDEKVFA FANNIHNHEG GTHLIGFKAA LTRTINAYGQ KNNLFKDLKD       300
     ELPSGDDMRE GLAAVISIRL PGASFEGQTK TKLSNTEAKS MVETMLNERL GAFLEENPNV       360
     AKRVCAKVAE ATRARIAARK ARETVRRKGA LDGASLPGKL ADCQSRDPRE SELFIVEGDS       420
     AGGSAKQGRD RRTQAILPLR GKILNVEKAR FDKMLSSAEI ATMITALGTG IGPEEYDVSK       480
     IRYHKIVIMT DADVDGSHIR TLLLTFFFRQ MPELVEKGYL YIAQPPLYRV QKGKKESYLK       540
     DEAALDDFLL QLGTEKAKLV AGDLVVEGAD LKRLAQDAIR YRGLLARVDR RRDSRIVDAA       600
     VQLGDLDLEL LKHHEQVKEQ VQKIFDKAQK LHPELEVRLA KIERDEEHGC DALVFQTTMS       660
     GATRTTRIDF DYLSGPEWGE LAGLYGELAE LGAGPHKLRT GDGEEEVDDV FGAVEVLKRA       720
     ATAGQTIQRY KGLGEMNPEQ LWETTMDHAR RTLLQVRVDD TVEADEVFSV LMGDAVEPRR       780
     EFIEKHALDV QNLDI                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page