(data stored in ACNUC7421 zone)

EMBL: CP000769.PE402

CP000769.PE402       Location/Qualifiers
FT   CDS             464076..464600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24622"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C6"
FT                   /protein_id="ABS24622.1"
FT                   /translation="MLLKETALVRLLSLRIPVLLFVAPRVKRLDDEVCEIEIPLGWRTR
FT                   NHLGSMYFGALCVGADLAGGLHAARLTTFGPYRGVNLVFADVRGEFLKRADGDVLFRCT
FT                   DGARVAAAVRETHERGERVTLPVEIAAFVPEKYGDEAVARFTLALSLKRATGAPMRVVA
FT                   TPPSRGNAAGA"
     MLLKETALVR LLSLRIPVLL FVAPRVKRLD DEVCEIEIPL GWRTRNHLGS MYFGALCVGA        60
     DLAGGLHAAR LTTFGPYRGV NLVFADVRGE FLKRADGDVL FRCTDGARVA AAVRETHERG       120
     ERVTLPVEIA AFVPEKYGDE AVARFTLALS LKRATGAPMR VVATPPSRGN AAGA             174
//

If you have problems or comments...

PBIL Back to PBIL home page