(data stored in ACNUC7421 zone)

EMBL: CP000769.PE404

CP000769.PE404       Location/Qualifiers
FT   CDS             464862..465992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0409"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: ade:Adeh_4014
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24624"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C8"
FT                   /protein_id="ABS24624.1"
FT                   /translation="MRAYVLPDERLRKLAGRFVWLDIDTEKPRNAAFVERFPIDAWPSI
FT                   LIVNPEDERVLVRWAGTATAEQIERLALDGERALRAGKASRAEEALARADRLLGERRHA
FT                   EAAAAFQEALAAGGPRFAARERASEAAVQSLGLAGAATECAATAQKLLPSLGGASAARV
FT                   AAQGISCALEQEEVAARRSAVAALEPRARGLLDDRRVLADDRSWLYDVLSSARSEAGDD
FT                   AGAKALARRWLAFLEREAARAKTPLARSAFDGQRLQAALRSGEPARALPALLASERDLP
FT                   HEYVPPTNLGVLYLALDRPAEALAAADRALALAEGPRRIRVLVLRAEAQAKAGDGAGAR
FT                   ATLERAVQEGEALPEAARPRGYLRKAKKLLGELRAS"
     MRAYVLPDER LRKLAGRFVW LDIDTEKPRN AAFVERFPID AWPSILIVNP EDERVLVRWA        60
     GTATAEQIER LALDGERALR AGKASRAEEA LARADRLLGE RRHAEAAAAF QEALAAGGPR       120
     FAARERASEA AVQSLGLAGA ATECAATAQK LLPSLGGASA ARVAAQGISC ALEQEEVAAR       180
     RSAVAALEPR ARGLLDDRRV LADDRSWLYD VLSSARSEAG DDAGAKALAR RWLAFLEREA       240
     ARAKTPLARS AFDGQRLQAA LRSGEPARAL PALLASERDL PHEYVPPTNL GVLYLALDRP       300
     AEALAAADRA LALAEGPRRI RVLVLRAEAQ AKAGDGAGAR ATLERAVQEG EALPEAARPR       360
     GYLRKAKKLL GELRAS                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page