(data stored in ACNUC7421 zone)

EMBL: CP000769.PE411

CP000769.PE411       Location/Qualifiers
FT   CDS             472702..473835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0416"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; KEGG: ade:Adeh_4008 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24631"
FT                   /db_xref="GOA:A7H7D5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D5"
FT                   /protein_id="ABS24631.1"
FT                   /translation="MFGRTPLAAAIQALRAELAGGPRADLGRDVRELADLLSARAQRRP
FT                   GTLYPEAPEQELLAALPDAAALVSREGWVRVSNAAFDTLAATGRAAGLTPLEITRSAEL
FT                   SEAVRRALEGTARRLDLQLGRRSYLVHLAPLLRGEVLLSLRDVTEARRAEATRRDFVAN
FT                   ASHELRTPVAAIRAAAETLLAGAVDDPAGARQFVEIVARQAERLARLTEDLLDLSRLES
FT                   RQWSFDLAPVDAAAVSTQAVELLALTARDKGLEIAAEVPAGATVRADARALEQVLVNLL
FT                   DNAVKYTGEGEVTLRGERDGDAWVLSVADTGPGIDRHHLPRIFERFYRIDAGRSREQGG
FT                   SGVGLAIVKHLVQGMGGEVGVESGTGGTRFWVRLPAV"
     MFGRTPLAAA IQALRAELAG GPRADLGRDV RELADLLSAR AQRRPGTLYP EAPEQELLAA        60
     LPDAAALVSR EGWVRVSNAA FDTLAATGRA AGLTPLEITR SAELSEAVRR ALEGTARRLD       120
     LQLGRRSYLV HLAPLLRGEV LLSLRDVTEA RRAEATRRDF VANASHELRT PVAAIRAAAE       180
     TLLAGAVDDP AGARQFVEIV ARQAERLARL TEDLLDLSRL ESRQWSFDLA PVDAAAVSTQ       240
     AVELLALTAR DKGLEIAAEV PAGATVRADA RALEQVLVNL LDNAVKYTGE GEVTLRGERD       300
     GDAWVLSVAD TGPGIDRHHL PRIFERFYRI DAGRSREQGG SGVGLAIVKH LVQGMGGEVG       360
     VESGTGGTRF WVRLPAV                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page