(data stored in ACNUC7421 zone)

EMBL: CP000769.PE413

CP000769.PE413       Location/Qualifiers
FT   CDS             475217..476029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0418"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   ade:Adeh_4006 ABC transporter, periplasmic phosphate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24633"
FT                   /db_xref="GOA:A7H7D7"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D7"
FT                   /protein_id="ABS24633.1"
FT                   /translation="MKRTLIALVAAIAPALASAAVTVKGSDTMVILAQRWAESYMKQNA
FT                   GKRVQVTGGGSGVGIAALINGTTDIANASRDMKSAEKAKVRERYNVLPTEIAVAKDGVA
FT                   VYVNAGNPVEQLTIEQLEKIYAGDVTNWKDVGGSDAPIVLYSRENSSGTYVFFKENVLK
FT                   GADFASSAQTLPGTAAVVNAVSKEKNGIGYGGAAYAKGVKEVKVVGADGKGYAPDADSV
FT                   ATGKYPLARPLFMYTRAKPAGEVKAFIDYCLSPEGQKIVTQVGYFPVK"
     MKRTLIALVA AIAPALASAA VTVKGSDTMV ILAQRWAESY MKQNAGKRVQ VTGGGSGVGI        60
     AALINGTTDI ANASRDMKSA EKAKVRERYN VLPTEIAVAK DGVAVYVNAG NPVEQLTIEQ       120
     LEKIYAGDVT NWKDVGGSDA PIVLYSRENS SGTYVFFKEN VLKGADFASS AQTLPGTAAV       180
     VNAVSKEKNG IGYGGAAYAK GVKEVKVVGA DGKGYAPDAD SVATGKYPLA RPLFMYTRAK       240
     PAGEVKAFID YCLSPEGQKI VTQVGYFPVK                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page