(data stored in ACNUC7421 zone)

EMBL: CP000769.PE414

CP000769.PE414       Location/Qualifiers
FT   CDS             476112..477089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0419"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ade:Adeh_4005
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24634"
FT                   /db_xref="GOA:A7H7D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D8"
FT                   /protein_id="ABS24634.1"
FT                   /translation="MVGSEERARPAPSMRRRQIREAAIQAAITLVALTGIAAVVLIFVF
FT                   VAREALPIFTSPEVREETDLARMFLPQAWREGRAAFFSWQPVSDVPKYSMVPLFVGTLK
FT                   VTAVAMLVSVPVGIAAAVFTSEFAPRRLREVLKPTIELLAGIPSVVLGFFALMVMATVL
FT                   QGAFGFTSRLNAIVAGLALALTVVPVIFTVSEDALAAVPRSYREASLALGATRWETSFK
FT                   VVLPAAAPGVLAAVVLGFGRSIGETMIVLMASGNAAMTTWSLGDSVRTLPATIAAEMGE
FT                   VVFGGAHYSVLFFIGVELFLFTFVLNMLASLFVKRLVRRMAGTA"
     MVGSEERARP APSMRRRQIR EAAIQAAITL VALTGIAAVV LIFVFVAREA LPIFTSPEVR        60
     EETDLARMFL PQAWREGRAA FFSWQPVSDV PKYSMVPLFV GTLKVTAVAM LVSVPVGIAA       120
     AVFTSEFAPR RLREVLKPTI ELLAGIPSVV LGFFALMVMA TVLQGAFGFT SRLNAIVAGL       180
     ALALTVVPVI FTVSEDALAA VPRSYREASL ALGATRWETS FKVVLPAAAP GVLAAVVLGF       240
     GRSIGETMIV LMASGNAAMT TWSLGDSVRT LPATIAAEMG EVVFGGAHYS VLFFIGVELF       300
     LFTFVLNMLA SLFVKRLVRR MAGTA                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page